PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_17043
Common NameKK1_017548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 338aa    MW: 38283.8 Da    PI: 6.3038
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_17043genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
    C.cajan_17043 14 KGPWTTEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.62.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
    C.cajan_17043  67 RGRFSFEEEETIIQLHSILGNK-WSAIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.331961IPR017930Myb domain
SuperFamilySSF466894.77E-3211108IPR009057Homeodomain-like
SMARTSM007173.3E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001672.02E-121661No hitNo description
PROSITE profilePS5129425.08762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001671.54E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTTE EDQKLVDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIASRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDISSILN ASFYGSSQMF LGMQHSLVNP ELLRLASSII SSQQHKDSNT  180
CAHKSDQQNQ LCHPQIPEFV QFQDPVQEVP ACTMFNTTTC VSLPITQPQL VEPNNVDPYP  240
SSNDYVPQLS SCNYYSSDGQ SLTYPPLSEP STFYSSNSNQ NFNFASVLST PSSSSTPLNS  300
NSTIINGSST EDERDQSYDS SYMLKFEIPD ILDVNEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312020.0KT031202.1 Glycine max clone HN_CCL_70 MYB/HD-like transcription factor (Glyma13g32090.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517902.10.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A151T7H60.0A0A151T7H6_CAJCA; Transcription factor MYB39
STRINGGLYMA15G07230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-110MYB-like 102